Name :
TGFA (Human) Recombinant Protein
Biological Activity :
Human TGFA recombinant protein with polyhistidine tag at the C-terminus expressed in Escherichia coli.Bioactive Protein,Bioactive Proteins,Bioactive,Active,Functional Protein,Functional Proteins
Tag :
Result of activity analysis
Protein Accession No. :
Protein Accession No.URL :
https://www.ncbi.nlm.nih.gov/gene?cmd=Retrieve&dopt=Graphics&list_uids=7039
Amino Acid Sequence :
MVVSHFNDCPDSHTQFCFHGTCRFLVQEDKPACVCHSGYVGARCEHADLLA with polyhistidine tag at the C-terminus.
Molecular Weight :
Storage and Stability :
Lyophilized protein should be stored at -20°C. Protein aliquots should be stored at-20°C to -80°C. This product is stable for one year. Avoid repeated freeze/thaw cycles.
Host :
Escherichia coli
Interspecies Antigen Sequence :
Preparation Method :
Escherichia coli expression system
Purification :
Ni-NTA chromatography
Quality Control Testing :
SDS-PAGE Stained with Coomassie Blue. SDS-PAGE analysis of TGFA (Human) Recombinant Protein.
Storage Buffer :
Lyophilized from a solution containing 1X PBS, pH 8.0. Reconstitute the lyophilized powder in ddH2O to 100 ug/mL.
Applications :
Functional Study， SDS-PAGE，
Gene Name :
TGFA
Gene Alias :
TFGA
Gene Description :
transforming growth factor, alpha
Gene Summary :
Transforming growth factors (TGFs) are biologically active polypeptides that reversibly confer the transformed phenotype on cultured cells. TGF-alpha shows about 40% sequence homology with epidermal growth factor (EGF; MIM 131530) and competes with EGF for binding to the EGF receptor (MIM 131550), stimulating its phosphorylation and producing a mitogenic response.[supplied by OMIM
Other Designations :
transforming growth factor-alpha
MedChemExpress (MCE) recombinant proteins include: cytokines, enzymes, growth factors, hormones, receptors, transcription factors, antibody fragments, etc. They are often essential for supporting cell growth, stimulating cell signaling pathways, triggering or inhibiting cell differentiation; and are useful tools for elucidating protein structure and function, understanding disease onset and progression, and validating pharmaceutical targets. At MedChemExpress (MCE), we strive to provide products with only the highest quality. Protein identity, purity and biological activity are assured by our robust quality control and assurance procedures.
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
Popular product recommendations:
KGF/FGF-7 Proteincustom synthesis
GM-CSF Proteinmanufacturer
Popular categories:
Complement Factor B
Caspase 14
